HORDB

ID: hor003923
Uniprot ID: Q9YGK2
Protein name: Corticotropin-like intermediary peptide
Gene name: pomc
Organism: Thunnus obesus (Bigeye tuna)
Family: POMC family
Source: animal
Expression: NA
Disease: NA
Comments: NA
Taxonomy: Thunnus (genus), Thunnini (tribe), Scombrinae (subfamily), Scombridae (family), Scombriformes (order), Pelagiaria, Percomorphaceae, Euacanthomorphacea, Acanthomorphata, Ctenosquamata, Eurypterygia, Neoteleostei, Euteleosteomorpha (cohort), Clupeocephala, Osteoglossocephalai, Teleostei (infraclass), Neopterygii (subclass), Actinopteri (class), Actinopterygii (superclass), Euteleostomi, Teleostomi, Gnathostomata, Vertebrata, Craniata (subphylum), Chordata (phylum), Deuterostomia, Bilateria, Eumetazoa, Metazoa (kingdom), Opisthokonta, Eukaryota (superkingdom), cellular organisms
GO MF: GO:0005179 hormone activity
GO BP: GO:0007218 neuropeptide signaling pathway
GO CC: GO:0005576 extracellular region

Sequence: PVKVYTSNGVEEESAEVFPGEM
Length: 22
Propeptide: MCPVWLLVAVVVVGGSRGAVSQCWEHPSCQELNSDSSMMECIQLCHSDLTAEKPVIPGNAHLQPPPLPDPSSSSSFILPSSSSSSSSPQSKRSYSMEHFRWGKPVGRKRRPVKVYTSNGVEEESAEVFPGEMRRRELASELLAAAEEEEEKAQEVMAEEEEEQKQLLQEKKDGSYKMKHFRWSGPPASKRYGGFMKSWDERSQRPLLTLFKNVINKDGQQQK
Signal peptide: MCPVWLLVAVVVVGGSRG
Modification: NA
Glycosylation: NA
Mutagenesis: NA

Function: [Corticotropin]: Stimulates the adrenal glands to release cortisol.; [Melanocyte-stimulating hormone alpha]: Anorexigenic peptide. Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Melanocyte-stimulating hormone beta]: Increases the pigmentation of skin by increasing melanin production in melanocytes.; [Beta-endorphin]: Endogenous orexigenic opiate.; [Met-enkephalin]: Endogenous opiate.
Mechanism: NA
Cross BBB: NA
Target: NA
Target Unid: NA
IC50: NA
EC50: NA
ED50: NA
kd: NA
Half life: NA

Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)

hor003923_AF2.pdb

hor003923_ESM.pdb

Mass:	277335	Formula:	C105H160N24O38S
Absent amino acids:	CDHILQRW	Common amino acids:	E
pI:	3.71	Basic residues:	1
Polar residues:	7	Hydrophobic residues:	6
Hydrophobicity:	-41.82	Boman Index:	-3057
Half-Life:	>20 hour	Half-Life Yeast:	>20 hour
Half-Life E.Coli:	?	Aliphatic Index	57.27
Instability Index:	4273.18	Extinction Coefficient cystines:	1490
Absorbance 280nm:	70.95